Thermococcus sp. 4557: GQS_03685 Help Entry GQS_03685         CDS       T01588                                  Name (GenBank) ferredoxin 2 Organism the  Thermococcus sp. 4557 Pathway the00270   Cysteine and methionine metabolism the01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:the00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     GQS_03685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_10 Fer4_2 Fer4_21 Fer4_9 Fer4_16 Fer4_8 Fer4_4 Fer4_18 Fer4_3 Fer4_17 Fer4_13 Fer4_15 DUF6438 Motif Other DBs NCBI-ProteinID:  AEK72638 UniProt:  G0HNL0 LinkDB All DBs Position 706327..706530 Genome browser AA seq 67 aa AA seqDB search MPERIKVIVNEDRCYLCGGCAGVCPTLAIEVHSSGWEFLQDKCISCRICISACPVGALSA EPLEVSE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgccagagaggattaaagtcatcgtgaacgaggaccggtgctacctctgcgggggctgc gccggcgtctgccccacccttgcaatcgaagtgcactccagcggctgggagttcctccag gacaagtgcataagctgcaggatatgcatcagcgcctgtccagttggagcgctcagcgcc gaacccctggaggtgagcgaatga

DBGET integrated database retrieval system