Thermosynechococcus sp. CL-1: FFX45_04915 Help Entry FFX45_04915       CDS       T06232                                  Name (GenBank) RNA-binding protein hfq   KO K03666   host factor-I protein Organism thec  Thermosynechococcus sp. CL-1 Pathway thec02024   Quorum sensing thec03018   RNA degradation Brite KEGG Orthology (KO) [BR:thec00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     FFX45_04915  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     FFX45_04915  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:thec03019]     FFX45_04915    03036 Chromosome and associated proteins [BR:thec03036]     FFX45_04915 Messenger RNA biogenesis [BR:thec03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      FFX45_04915 Chromosome and associated proteins [BR:thec03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     FFX45_04915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 Hfq Motif Other DBs NCBI-ProteinID:  QEQ00780 LinkDB All DBs Position 966906..967124 Genome browser AA seq 72 aa AA seqDB search MTDEFNTALPSIRQLQTFIKDSTEVEVKLSTSDLVVGKVRWQDMNCLCVVDHYDQPTIIW KQAIVFIKPKLA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaccgacgaattcaatacggcactgcccagcattcgccagttgcagaccttcattaaa gatagcaccgaggttgaagtcaagctcagcaccagtgatctcgtggttggtaaggtgcgc tggcaggatatgaattgcctctgcgttgtcgatcactatgatcaacccaccattatttgg aagcaggccattgtctttattaaacccaagctagcctaa

DBGET integrated database retrieval system