Thermoanaerobacterium sp. RBIITD: SAMN05660242_3262 Help Entry SAMN05660242_3262 CDS       T10458                                  Name (GenBank) host factor-I protein   KO K03666   host factor-I protein Organism thed  Thermoanaerobacterium sp. RBIITD Pathway thed02024   Quorum sensing thed03018   RNA degradation Brite KEGG Orthology (KO) [BR:thed00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     SAMN05660242_3262  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     SAMN05660242_3262  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:thed03019]     SAMN05660242_3262    03036 Chromosome and associated proteins [BR:thed03036]     SAMN05660242_3262 Messenger RNA biogenesis [BR:thed03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      SAMN05660242_3262 Chromosome and associated proteins [BR:thed03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     SAMN05660242_3262 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  SNX55436 LinkDB All DBs Position I:3231185..3231439 Genome browser AA seq 84 aa AA seqDB search MNQKAAINLQDIFLNQVRKEHIAVTVYLINGFQLKGMVKGFDNFTVVLETDNKQQQLIYK HAVSTITPLKPVIFTTTEKDEKQQ NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaatcaaaaagcagctatcaatttacaagatatatttttaaaccaggttagaaaggaa catatagcagtaacagtatacttgattaacggttttcagttaaaaggaatggttaaaggt tttgataattttaccgttgttttagagacagataataaacagcagcaacttatctataaa catgctgtttctacaataactcctttaaaacctgtaatatttacgacaacagaaaaagat gaaaagcaacagtaa

DBGET integrated database retrieval system