Thermomonas sp. HDW16: G7079_03355 Help Entry G7079_03355       CDS       T06498                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism theh  Thermomonas sp. HDW16 Pathway theh00290   Valine, leucine and isoleucine biosynthesis theh00650   Butanoate metabolism theh00660   C5-Branched dibasic acid metabolism theh00770   Pantothenate and CoA biosynthesis theh01100   Metabolic pathways theh01110   Biosynthesis of secondary metabolites theh01210   2-Oxocarboxylic acid metabolism theh01230   Biosynthesis of amino acids Module theh_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine theh_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:theh00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     G7079_03355    00660 C5-Branched dibasic acid metabolism     G7079_03355   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     G7079_03355   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     G7079_03355 Enzymes [BR:theh01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      G7079_03355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss Motif Other DBs NCBI-ProteinID:  QIL19845 UniProt:  A0A6G7ZSW4 LinkDB All DBs Position complement(758086..758322) Genome browser AA seq 78 aa AA seqDB search MRYRLDLTLRQAEGALARVLGTAERRGFRPLAVEGEAQSEGDRWHLQMTVEGDRTADNLH EQLSKLYDCLDVQVQPCN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcgctatcgactcgacctcaccctgcgccaggccgaaggcgcgctcgcccgcgtgctc ggcaccgccgaacgccgcggcttccggccgctggcggtggaaggcgaagcccaatccgaa ggtgaccgctggcacctgcagatgaccgtggaaggcgaccgcaccgccgacaacctgcat gagcagctatccaagctgtacgactgtctggacgtgcaggtgcagccatgcaattga

DBGET integrated database retrieval system