KEGG   Thermomonas sp. HDW16: G7079_08820
Entry
G7079_08820       CDS       T06498                                 
Name
(GenBank) LD-carboxypeptidase
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
theh  Thermomonas sp. HDW16
Brite
KEGG Orthology (KO) [BR:theh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:theh01002]
    G7079_08820
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:theh01011]
    G7079_08820
Enzymes [BR:theh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     G7079_08820
Peptidases and inhibitors [BR:theh01002]
 Serine peptidases
  Family S66
   G7079_08820
Peptidoglycan biosynthesis and degradation proteins [BR:theh01011]
 Precursor biosynthesis
  Carboxypeptidase
   G7079_08820
SSDB
Motif
Pfam: Peptidase_S66 Peptidase_S66C
Other DBs
NCBI-ProteinID: QIL20827
LinkDB
Position
complement(1894490..1895548)
AA seq 352 aa
MVCIGMNRRQFIGNAALAASLLPFAGVAGTVEAAPRRRLLPVALDKGDRVGLVSPSSASD
DSFSLQLAREAMEALGFEVKTGAHFAGRRGYLAGSDAERADDLNTMFADKTVKAIVCTRG
GSGGARLLPLLDYETIRRNPKTLLGYSDITALHSAIHAKTGLVTFHGQIGSGSWNAFNVD
QFQRVFFKRELMEYRNKIELGDELVPRRNRTITITGGKARGELVGGNLTVLAALAGSPFL
PDFGGKILFLEDVGEAPYRIDRMLSTLKLMGALDKIAGFIFGECTDCKPGDGYGSLTLEQ
ILDDYIKPLQIPAYRGAMIGHIREQFIVPVGGQVELDADTGSFRLLEPVFQS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggtttgcatcggcatgaacagacggcaattcatcggcaatgcggcgttggcggcatcc
ttgctgccgttcgccggagttgcgggcaccgtggaagcggcaccacgcaggcgcctgttg
ccggttgccctcgacaagggcgatcgcgtggggttggtgagtccctcatcggcatcggat
gacagtttcagcctgcaattggcccgcgaagcgatggaagcgctcggcttcgaggtcaaa
accggtgcgcacttcgccggccggcgcggatacttggctggcagtgatgccgaacgcgcc
gacgatctcaatacgatgttcgccgacaagacggtcaaggccatcgtctgcactcgcggc
ggatccggtggcgcgcgcctgttgccattgctggattacgaaacgatccgccggaatccg
aagacattgctgggctattccgacatcaccgccttgcacagcgcaatccatgcgaagacc
ggtctggtgaccttccacgggcagatcggatccggcagctggaacgcgttcaatgtcgac
cagttccagcgcgtgttcttcaagcgcgagttgatggaataccgcaacaagatcgaactc
ggcgatgagcttgtaccacggcgcaaccgcaccatcaccatcactggtggcaaggcacgc
ggcgaactggtgggtggcaacctgaccgtgcttgctgcattggccggttcgccgtttctg
ccggatttcggcggcaagatcctgttcctggaggacgtgggcgaagcgccgtaccgcatc
gaccgcatgttgagcacgttgaagctgatgggggcgctggacaagatcgcaggtttcatc
tttggcgagtgcaccgattgcaagcccggcgacggatacggttcgctcacgcttgagcag
atcctcgacgattacatcaagccgctacagatcccagcctaccgcggtgcgatgatcggc
cacatccgcgagcagttcatcgtgccggtgggcggccaggtggagctggatgccgatacg
ggttcgttccgcttgctggaaccggtctttcagtcctga

DBGET integrated database retrieval system