Thermomonas sp. HDW16: G7079_12290 Help Entry G7079_12290       CDS       T06498                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism theh  Thermomonas sp. HDW16 Brite KEGG Orthology (KO) [BR:theh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:theh03036]     G7079_12290 (ftsL) Chromosome and associated proteins [BR:theh03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     G7079_12290 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Phenyl_P_gamma CurL-like_PKS_C Motif Other DBs NCBI-ProteinID:  QIL21453 UniProt:  A0A6G7ZXC4 LinkDB All DBs Position complement(2591714..2591980) Genome browser AA seq 88 aa AA seqDB search MNRYVILAVLVIANVATALLVVRDRHEHRLAFIALNKLDKIRDELNIEFGRLQLEQATWA ESNRVDQVARTRLGMVFPRTEDIVVLRR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaaccgctacgtcatcctcgccgtgctggtgatcgccaacgtggcgacggcgctgctg gtggtgcgtgatcgccacgagcaccgcctggccttcatcgcgctcaacaagctggacaag atccgcgacgaactcaacatcgaattcggccgcctgcagctggaacaggcgacctgggcg gagagcaaccgcgtcgaccaggtcgcgcgcacccgccttggcatggtgttcccgcgtacc gaagacatcgtggtgttgcgccgatga

DBGET integrated database retrieval system