Thermococcus argininiproducens: K1720_03210 Help Entry K1720_03210       CDS       T08316                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism thei  Thermococcus argininiproducens Pathway thei03010   Ribosome Brite KEGG Orthology (KO) [BR:thei00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     K1720_03210   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     K1720_03210  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:thei03011]     K1720_03210    04121 Ubiquitin system [BR:thei04121]     K1720_03210   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:thei04147]     K1720_03210 Ribosome [BR:thei03011]  Ribosomal proteins   Eukaryotes    Small subunit     K1720_03210   Archaea     K1720_03210 Ubiquitin system [BR:thei04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    K1720_03210 Exosome [BR:thei04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    K1720_03210   Exosomal proteins of colorectal cancer cells    K1720_03210 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Ribosomal_L37e Zn_ribbon_RPB9 Zn_ribbon_NUD Zn_ribbon_IS1595 DZR GFA Zn_ribbon_Nudix Zn_ribbon_3 Zn_Ribbon_1 zf-FPG_IleRS Motif Other DBs NCBI-ProteinID:  USH00483 UniProt:  A0A9E7MBK9 LinkDB All DBs Position 605956..606123 Genome browser AA seq 55 aa AA seqDB search MAGKKTSQKWKFYEVKDGKVSRKNRFCPRCGPGVFMANHKDRWTCGRCGYTEWKR NT seq 168 nt NT seq  +upstreamnt  +downstreamnt atggctggtaagaagacatcccaaaagtggaagttctacgaagttaaggatggcaaggtc tcaaggaagaacagattctgcccaagatgcggcccaggagttttcatggcaaaccacaaa gacagatggacatgcggtagatgcggttacactgagtggaagagatga

DBGET integrated database retrieval system