Thermococcus argininiproducens: K1720_05125 Help Entry K1720_05125       CDS       T08316                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism thei  Thermococcus argininiproducens Pathway thei03010   Ribosome Brite KEGG Orthology (KO) [BR:thei00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     K1720_05125   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     K1720_05125  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:thei03011]     K1720_05125    04121 Ubiquitin system [BR:thei04121]     K1720_05125 Ribosome [BR:thei03011]  Ribosomal proteins   Eukaryotes    Large subunit     K1720_05125   Archaea     K1720_05125 Ubiquitin system [BR:thei04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    K1720_05125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 Zn_ribbon_RPAB4 Ribosomal_L40e DZR Toxin_5 DZR_2 zf-nanos Zn_ribbon_10 Zn_ribbon_3 Ribosomal_L37e HypA Motif Other DBs NCBI-ProteinID:  USH00900 UniProt:  A0A9E7MBH4 LinkDB All DBs Position 970383..970541 Genome browser AA seq 52 aa AA seqDB search MARFPEAEARIFRKYICMRCGATNPWKAEKCRKCGYKGLRAKAREPRGGAGR NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggcgaggtttcctgaagctgaggcaaggatatttaggaagtacatatgtatgaggtgc ggtgctactaatccatggaaagcagaaaaatgcagaaagtgtggatacaagggactaaga gcaaaagctagagagccaagaggaggagctggacgttag

DBGET integrated database retrieval system