Thermococcus argininiproducens: K1720_10605 Help Entry K1720_10605       CDS       T08316                                  Name (GenBank) histone family protein   KO K24450   DNA-binding protein Organism thei  Thermococcus argininiproducens Brite KEGG Orthology (KO) [BR:thei00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:thei03036]     K1720_10605 Chromosome and associated proteins [BR:thei03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     K1720_10605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CENP-S TAF TFIID-31kDa Bromo_TP TFIID_20kDa TFIID-18kDa CENP-X DUF1931 LonB_AAA-LID Motif Other DBs NCBI-ProteinID:  USG99911 UniProt:  A0A9E7M9J0 LinkDB All DBs Position 1944124..1944327 Genome browser AA seq 67 aa AA seqDB search MAELPIAPIDRLIRKAGAERVSEDAAKVLAEYLEEYAVELAKKSVEFARHAGRKTVKAED IKLAIKA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggctgagttgccaattgccccaattgataggttgattagaaaggctggtgctgagaga gttagcgaagatgccgccaaagtacttgccgaatacctcgaagagtacgcagttgagctt gctaagaagtcagttgagtttgctagacacgctggcagaaagacagtcaaagcagaagac atcaaactcgctatcaaagcttga

DBGET integrated database retrieval system