Infirmifilum lucidum: IG193_05000 Help Entry IG193_05000       CDS       T06910                                  Name (GenBank) 4Fe-4S binding protein   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism thel  Infirmifilum lucidum Pathway thel00010   Glycolysis / Gluconeogenesis thel00020   Citrate cycle (TCA cycle) thel00620   Pyruvate metabolism thel00633   Nitrotoluene degradation thel00640   Propanoate metabolism thel00650   Butanoate metabolism thel00680   Methane metabolism thel00720   Other carbon fixation pathways thel01100   Metabolic pathways thel01110   Biosynthesis of secondary metabolites thel01120   Microbial metabolism in diverse environments thel01200   Carbon metabolism thel01210   2-Oxocarboxylic acid metabolism Module thel_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:thel00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     IG193_05000    00020 Citrate cycle (TCA cycle)     IG193_05000    00620 Pyruvate metabolism     IG193_05000    00640 Propanoate metabolism     IG193_05000    00650 Butanoate metabolism     IG193_05000   09102 Energy metabolism    00720 Other carbon fixation pathways     IG193_05000    00680 Methane metabolism     IG193_05000   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     IG193_05000 Enzymes [BR:thel01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase (ferredoxin)      IG193_05000 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_10 Fer4_6 Fer4_7 Fer4_2 Fer4_9 Fer4_16 LdpA_Fe-S-bd Fer4_13 Fer4_4 Fer4_15 Fer4_8 Fer4_17 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  QOJ78146 UniProt:  A0A7L9FGU6 LinkDB All DBs Position complement(897631..897930) Genome browser AA seq 99 aa AA seqDB search MSGESVVLKLKTWRDLPIGGIIPEPKTSLHNKTGNWRAMKPILDNGKCIKCLLCWIHCPE PAILRGDDDSVRIDYDYCKGCGICANVCPVHAIEMKLEV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagtggtgagagtgtagttttaaagcttaaaacatggagagacctacctattggcggc ataatacccgagcctaagacaagcctccacaacaagactgggaactggcgcgccatgaag ccgatccttgataacgggaagtgcataaagtgcctgctatgctggattcactgcccagag cctgctatattgagaggtgacgacgactctgtcaggatagactacgactactgtaagggc tgtgggatatgtgcgaacgtgtgcccggtgcacgctattgagatgaagctcgaggtgtga

DBGET integrated database retrieval system