Infirmifilum lucidum: IG193_06095 Help Entry IG193_06095       CDS       T06910                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism thel  Infirmifilum lucidum Pathway thel03010   Ribosome Brite KEGG Orthology (KO) [BR:thel00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     IG193_06095   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     IG193_06095  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:thel03011]     IG193_06095    04121 Ubiquitin system [BR:thel04121]     IG193_06095 Ribosome [BR:thel03011]  Ribosomal proteins   Eukaryotes    Large subunit     IG193_06095   Archaea     IG193_06095 Ubiquitin system [BR:thel04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    IG193_06095 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e DZR Zn_Ribbon_1 DZR_2 HypA zf-ChsH2 Motif Other DBs NCBI-ProteinID:  QOJ78332 UniProt:  A0A7L9FG79 LinkDB All DBs Position complement(1084059..1084214) Genome browser AA seq 51 aa AA seqDB search MPIRDPEKLQLALDHHFKVKICRKCNARNPWEAERCRRCHSRDLRPKRYKK NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgcctattagagaccctgagaaactccagctagctctggatcaccactttaaggtaaag atatgtagaaaatgtaatgcgcgcaatccctgggaagctgaaaggtgtcgcaggtgtcac agccgcgaccttaggcctaagcggtacaagaagtag

DBGET integrated database retrieval system