Thermococcus aciditolerans: FPV09_04800 Help Entry FPV09_04800       CDS       T07677                                  Name (GenBank) histone family protein   KO K24450   DNA-binding protein Organism them  Thermococcus aciditolerans Brite KEGG Orthology (KO) [BR:them00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:them03036]     FPV09_04800 Chromosome and associated proteins [BR:them03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     FPV09_04800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa CENP-S Bromo_TP TFIID-18kDa TFIID_20kDa CENP-X DUF1931 LonB_AAA-LID Motif Other DBs NCBI-ProteinID:  QEK14533 UniProt:  A0A5C0SJE3 LinkDB All DBs Position 876005..876208 Genome browser AA seq 67 aa AA seqDB search MAELPIAPIDRLIRKAGAERVSEDAAKVLAEYLEEYAIELARKSADFARHAGRKTVKAED IKLAIKA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggccgagcttccgattgccccgattgacaggcttataaggaaggccggcgctgagagg gtcagcgaggacgctgccaaggttctcgctgagtacctcgaggagtacgccatcgagctt gccaggaagtccgccgactttgccaggcacgccggcaggaagaccgtcaaggccgaggac atcaagcttgccattaaggcctga

DBGET integrated database retrieval system