Thermococcus aciditolerans: FPV09_06240 Help Entry FPV09_06240       CDS       T07677                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism them  Thermococcus aciditolerans Pathway them03010   Ribosome Brite KEGG Orthology (KO) [BR:them00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     FPV09_06240   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     FPV09_06240  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:them03011]     FPV09_06240    04121 Ubiquitin system [BR:them04121]     FPV09_06240 Ribosome [BR:them03011]  Ribosomal proteins   Eukaryotes    Large subunit     FPV09_06240   Archaea     FPV09_06240 Ubiquitin system [BR:them04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    FPV09_06240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_Ribbon_1 DZR Ribosomal_L40e Zn_ribbon_RPAB4 Toxin_5 UPF0547 DZR_2 Zn_ribbon_10 Zn_ribbon_3 HypA Motif Other DBs NCBI-ProteinID:  QEK14762 UniProt:  A0A5C0SL54 LinkDB All DBs Position complement(1125016..1125174) Genome browser AA seq 52 aa AA seqDB search MARFPEAEARIFRKYVCMRCGATNPWKAKKCRKCGYKGLRPKAREPRGGMGR NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atggcgagattccccgaggctgaggccagaatctttaggaagtacgtgtgcatgcgctgc ggtgccactaacccgtggaaggccaagaagtgcaggaagtgcggctacaagggtctccgc ccgaaggcgagagagccgcgcggtggaatgggacgctga

DBGET integrated database retrieval system