Thermoflavifilum sp.: IMW88_06675 Help Entry IMW88_06675       CDS       T09844                                  Symbol atpC Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism theo  Thermoflavifilum sp. Pathway theo00190   Oxidative phosphorylation theo01100   Metabolic pathways Module theo_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:theo00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     IMW88_06675 (atpC)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:theo00194]     IMW88_06675 (atpC) Photosynthesis proteins [BR:theo00194]  Photosystem and electron transport system   F-type ATPase [OT]    IMW88_06675 (atpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QOR75066 LinkDB All DBs Position complement(1598153..1598434) Genome browser AA seq 93 aa AA seqDB search MLLEIYTPERKVFEGEVYGVQMPGLDGLFEVLNHHAPMIAALDKGRVKIIQQGDKHETCY YQISGGFVEVLNNKATILAESAIAEALPAAQEH NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctactcgaaatctatacccccgaacgaaaagtcttcgaaggcgaagtgtatggtgtg caaatgccggggctggatggattgtttgaagtgctcaaccaccacgcccccatgatcgcc gccctcgacaaaggacgcgtgaaaatcatccagcagggcgataaacatgaaacgtgttat tatcagatcagcggcggctttgtagaagtgctgaacaacaaagccactatcctggccgaa tcggccatagccgaagctcttccggctgcacaggagcactaa

DBGET integrated database retrieval system