Thermoflavifilum sp.: IMW88_12045
Help
Entry
IMW88_12045 CDS
T09844
Name
(GenBank) aspartate kinase
KO
K00928
aspartate kinase [EC:
2.7.2.4
]
Organism
theo
Thermoflavifilum sp.
Pathway
theo00260
Glycine, serine and threonine metabolism
theo00261
Monobactam biosynthesis
theo00270
Cysteine and methionine metabolism
theo00300
Lysine biosynthesis
theo01100
Metabolic pathways
theo01110
Biosynthesis of secondary metabolites
theo01120
Microbial metabolism in diverse environments
theo01210
2-Oxocarboxylic acid metabolism
theo01230
Biosynthesis of amino acids
Module
theo_M00527
Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:
theo00001
]
09100 Metabolism
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
IMW88_12045
00270 Cysteine and methionine metabolism
IMW88_12045
00300 Lysine biosynthesis
IMW88_12045
09110 Biosynthesis of other secondary metabolites
00261 Monobactam biosynthesis
IMW88_12045
Enzymes [BR:
theo01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.2 Phosphotransferases with a carboxy group as acceptor
2.7.2.4 aspartate kinase
IMW88_12045
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AA_kinase
ACT_9
ACT_7
Motif
Other DBs
NCBI-ProteinID:
QOR76007
LinkDB
All DBs
Position
complement(2824134..2825456)
Genome browser
AA seq
440 aa
AA seq
DB search
MKIMKFGGTSVGKPERMHAVARLILSEPEDKIVVLSALSGTTNTLVQISKALADGHRDQA
KQIIDDLRKHYDAFCEGLLQTSEARVKARDIVNHHFEFLEIILKISFSEALERDILAQGE
LLSTQLFCTYLEEIQVPVVLLPALEFMYIDEYHEPVLAKIKTKLTALLQQYPDQHLFVTQ
GYICRNARGEVDNLKRGGSDYTASLIGAAVQASEIQIWTDIDGMHNNDPRVVKNTFPIER
LSFDEAAELAYFGAKILHPASIWPAQFFNIPVRLLNTMQPEARGTLITDQATGEGVKAVA
AKDGITAIKIKSSRMLLAYGFLRKVFEVFEKYRTPIDMITTSEVAVSLTIDQIVHLENIQ
RELEAYGSVEVEHDQTIIAIVGNEIVSQKAILKNMFAALEPIPLRMISYGGSRHNVSLLI
HSTHKEQALRALNKGLFGLD
NT seq
1323 nt
NT seq
+upstream
nt +downstream
nt
atgaaaattatgaaatttggcggtacatccgttggtaagcccgaacgcatgcatgccgtt
gcccggcttatcctatccgagccggaagataagattgtggtgctttccgcactttccggc
acaaccaacacgctggtgcagatcagcaaggcgctggccgatggccatcgcgatcaggcc
aaacagataatcgatgatttgcgcaaacattacgatgcattctgcgaaggcctgttgcaa
acatccgaagctcgcgtgaaagcccgtgatatcgtgaatcatcattttgaatttctggaa
attatcctgaagatttctttcagtgaagctctggaacgcgatatcctggctcagggcgaa
ttactttccacacaactgttttgcacctatctggaagaaattcaggtgccggtggtgttg
ttgcctgcattggaattcatgtatatcgatgaatatcacgaaccggtgctggccaagatc
aaaacaaaacttacggcattattgcaacaatatcctgatcaacatctgtttgtcacgcag
ggatatatctgtagaaatgcccgtggtgaagtggataacctcaagcgcggaggaagtgat
tacaccgcatctctgattggagccgccgttcaagcttccgaaatacaaatatggaccgac
atcgatggtatgcataacaacgacccgcgggtggtaaaaaacacgtttccgattgaacga
ctttcgtttgatgaagcagcggagctggcctatttcggtgcgaagattctgcacccggct
tctatttggcccgctcagttcttcaatattccagtacgcttgctcaataccatgcaaccc
gaagcccggggtacactgatcaccgatcaggccacgggtgagggcgtaaaggccgtggct
gcaaaagacggcatcaccgcgatcaaaatcaaatcgagccgcatgctgctggcttatgga
tttttgagaaaagtatttgaagtatttgaaaaatatcgtacgcctattgacatgataacc
acttctgaagtggccgtgtcattgacaattgaccagattgtgcatctggaaaatattcaa
cgcgagctggaggcctacggcagcgtggaagtagagcacgatcaaaccatcatcgctatt
gtggggaatgaaattgtttctcagaaagctattctgaaaaatatgtttgcagcacttgag
cccattcctttacgcatgatttcttatggtggcagtcggcataacgtatcgttgcttatc
catagtactcacaaagagcaggccttgcgtgcattgaacaaaggcctgttcgggctggat
taa
DBGET
integrated database retrieval system