Thermaerobacter sp. PB12/4term: DYI95_009595 Help Entry DYI95_009595      CDS       T06418                                  Name (GenBank) hypothetical protein   KO K00020   3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31] Organism thep  Thermaerobacter sp. PB12/4term Pathway thep00280   Valine, leucine and isoleucine degradation thep01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:thep00001]  09100 Metabolism   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     DYI95_009595 Enzymes [BR:thep01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.31  3-hydroxyisobutyrate dehydrogenase      DYI95_009595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NAD_binding_2 Shikimate_DH 3HCDH_N F420_oxidored 2-Hacid_dh_C ApbA NAD_Gly3P_dh_N Motif Other DBs NCBI-ProteinID:  QIA27730 UniProt:  A0A8T8DB91 LinkDB All DBs Position complement(2293682..2293924) Genome browser AA seq 80 aa AA seqDB search MPLHRVGWIGLGAMGSRMARNPIKAGFEVDVWNRTPARAEELGRVVRLGRHEHHRAAGRP GVRRRSPGVGHPLRRSAGQR NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcctttgcaccgcgtggggtggatcggccttggcgccatggggagtcgcatggcgcgc aacccgatcaaagcgggttttgaggtggacgtgtggaaccggacgccggcccgggcggag gaactcggccgggtggttcgtctgggtcgacatgagcaccatcgggccgcaggccgcccg ggagttcgccgccgaagcccgggagtggggcatccccttcgtcgaagcgccggtcagcgg tag

DBGET integrated database retrieval system