Thermosipho sp. 1070: Y592_01030 Help Entry Y592_01030        CDS       T04909                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ther  Thermosipho sp. 1070 Pathway ther00020   Citrate cycle (TCA cycle) ther00720   Other carbon fixation pathways ther01100   Metabolic pathways ther01110   Biosynthesis of secondary metabolites ther01120   Microbial metabolism in diverse environments ther01200   Carbon metabolism ther01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ther00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Y592_01030   09102 Energy metabolism    00720 Other carbon fixation pathways     Y592_01030 Enzymes [BR:ther01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Y592_01030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_2 Fer4_21 Fer4_4 Fer4_6 Fer4_9 Fer4_16 Fer4_15 Fer4_13 Fer4_3 Fer4_17 Fer4_18 Fer4_8 Motif Other DBs NCBI-ProteinID:  ANQ53119 LinkDB All DBs Position complement(208324..208551) Genome browser AA seq 75 aa AA seqDB search MAKKQFKVKINYNWCKSCGICYNTCPTKTIIKGEMNRPKVEDHTTCIGCLMCENLCPDFA IDIVEITEEVGEKNG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaaacagtttaaggtgaagataaattataattggtgtaaaagttgcgggata tgctataacacttgtcctacaaaaactattattaagggggaaatgaatagaccaaaagta gaagatcatacaacgtgtataggatgtttgatgtgtgaaaatttatgtccagattttgcc attgacatagttgagattacagaagaagtaggtgaaaaaaatgggtaa

DBGET integrated database retrieval system