Thermosipho sp. 1070: Y592_05480
Help
Entry
Y592_05480 CDS
T04909
Name
(GenBank) chemotaxis protein CheY
KO
K03413
two-component system, chemotaxis family, chemotaxis protein CheY
Organism
ther
Thermosipho sp. 1070
Pathway
ther02020
Two-component system
ther02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
ther00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
Y592_05480
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
Y592_05480
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
ther02022
]
Y592_05480
02035 Bacterial motility proteins [BR:
ther02035
]
Y592_05480
Two-component system [BR:
ther02022
]
CheA family
CheA-CheYBV (chemotaxis)
Y592_05480
Bacterial motility proteins [BR:
ther02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
Y592_05480
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
B12-binding
OYE-like_second_a-b
DUF2179
SIS_2
bPH_4
TadZ_N
Motif
Other DBs
NCBI-ProteinID:
ANQ53862
LinkDB
All DBs
Position
1090802..1091164
Genome browser
AA seq
120 aa
AA seq
DB search
MGKRILIVDDAAFMRMMLKDIIAKAGHEVVGEAANGKEAVEKYKELKPDIVTMDITMPEM
NGIEAIKEIKKIDPNATIIVCSAMGQQAMVIEAIQAGAKDFIVKPFQAARVIEAIQKVSG
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
atggggaagaggattttgatcgtggatgatgctgcatttatgaggatgatgttgaaagat
attattgctaaagctggtcatgaagtagtgggagaagcagcaaatggtaaagaagctgtg
gaaaaatacaaagaattaaaaccagatatcgtgactatggatattacaatgccggaaatg
aatggtatagaggctattaaagagattaaaaagatagatccaaatgcaacaattattgta
tgtagtgctatgggacaacaggcaatggttatagaagcaattcaggcgggagcaaaagat
tttatagttaaacccttccaagcagcaagggtaattgaggcaattcagaaagtatcaggt
tag
DBGET
integrated database retrieval system