Thermosipho sp. 1070: Y592_06305 Help Entry Y592_06305        CDS       T04909                                  Name (GenBank) YruB family glutaredoxin   KO K03676   glutaredoxin 3 Organism ther  Thermosipho sp. 1070 Brite KEGG Orthology (KO) [BR:ther00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ther03110]     Y592_06305 Chaperones and folding catalysts [BR:ther03110]  Protein folding catalysts   Protein disulfide isomerase    Y592_06305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like Thioredoxin_2 GST_N_2 ArsC Thioredoxin_3 Thioredoxin_4 AhpC-TSA Csx12 iHKD DUF417 GST_N Motif Other DBs NCBI-ProteinID:  ANQ54012 LinkDB All DBs Position complement(1235553..1235795) Genome browser AA seq 80 aa AA seqDB search MQHVKIIVYTTPTCPYCKKAKQYFKQLGLKFKEYDVSKDQKAAERMYKKSKQLGVPVIEI GNQVIVGFDKAKIDRLLNIN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcaacacgttaaaattattgtttacaccactccaacttgcccatattgtaaaaaggca aaacaatattttaagcaacttggattaaaatttaaagaatacgatgtttcaaaagatcaa aaagccgctgaaagaatgtacaaaaaaagcaaacaacttggtgtgcctgtaattgagatt ggaaatcaagttattgtaggattcgacaaagctaaaatagacaggttattaaatataaac taa

DBGET integrated database retrieval system