Thermosipho sp. 1070: Y592_07680 Help Entry Y592_07680        CDS       T04909                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism ther  Thermosipho sp. 1070 Brite KEGG Orthology (KO) [BR:ther00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ther03036]     Y592_07680 Chromosome and associated proteins [BR:ther03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Y592_07680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB SHE3 HALZ STAT_alpha FlgN DivIVA CCDC113_CCDC96_CC APC_N_CC GapR_DNA-bd DUF948 Crescentin Tropomyosin Peptidase_S46 CCDC22_CC bZIP_1 YabA ATP-synt_D OmpH ADIP Spc7 KASH_CCD Yuri_gagarin CENP-H RloB LRRFIP Wtap XRCC4_CC PI_PP_I Cep57_CLD_2 JIP_LZII DUF5685 ANC1_spectrin Spc24 NPR2 CCDC93_CC BLOC1_2 DUF1664 DUF1574 DUF3450 COG3_N Sas-6_C_CC UPF0242 Seryl_tRNA_N FapA NRBF2 DUF6809 Fib_alpha APG6_N TMPIT FlaC_arch Nnf1 DUF730 Motif Other DBs NCBI-ProteinID:  ANQ54276 LinkDB All DBs Position 1482735..1482980 Genome browser AA seq 81 aa AA seqDB search MEEKIRELEQLFDDLINKYEELKKENKELWKELNAAIERANQLEQENNALKEQIYGTFEK LLGKIKNVVETSAEINGEENA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggaggaaaaaataagagaacttgaacaactttttgatgatttgattaataaatacgaa gaacttaagaaagaaaacaaagaactttggaaggagttaaatgctgctattgaaagggct aatcagcttgagcaagaaaacaatgcattaaaagagcaaatttatggaacatttgaaaaa ttattgggaaaaataaaaaatgttgtggagacatcagcggagataaatggtgaagaaaac gcttga

DBGET integrated database retrieval system