Thermomonas aquatica: FHQ07_10720 Help Entry FHQ07_10720       CDS       T06025                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism thes  Thermomonas aquatica Pathway thes00290   Valine, leucine and isoleucine biosynthesis thes00650   Butanoate metabolism thes00660   C5-Branched dibasic acid metabolism thes00770   Pantothenate and CoA biosynthesis thes01100   Metabolic pathways thes01110   Biosynthesis of secondary metabolites thes01210   2-Oxocarboxylic acid metabolism thes01230   Biosynthesis of amino acids Module thes_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine thes_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:thes00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     FHQ07_10720    00660 C5-Branched dibasic acid metabolism     FHQ07_10720   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     FHQ07_10720   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     FHQ07_10720 Enzymes [BR:thes01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      FHQ07_10720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss Motif Other DBs NCBI-ProteinID:  QDA57745 UniProt:  A0A5B7ZST8 LinkDB All DBs Position complement(2270491..2270727) Genome browser AA seq 78 aa AA seqDB search MRYRLDLTLRHAEGALARVLGTAERRGFRPLAVEGETRPDGDRWHLQMTVEGDRTADNLH EQLAKLYDCLDVQVQPCS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcgctaccgactcgacctcaccctgcgccacgccgaaggcgcgctcgcgcgcgtgctc ggcaccgccgaacgccgcggcttccgcccgctcgcggtggaaggcgaaacccgccccgac ggcgaccgctggcacctgcagatgacggtggaaggcgaccgcaccgccgacaacctgcac gagcagctggccaagctgtacgactgcctggacgtgcaggtgcagccatgcagttga

DBGET integrated database retrieval system