Thermoleptolyngbya sichuanensis: HPC62_09740 Help Entry HPC62_09740       CDS       T06607                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism theu  Thermoleptolyngbya sichuanensis Brite KEGG Orthology (KO) [BR:theu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:theu03032]     HPC62_09740    03036 Chromosome and associated proteins [BR:theu03036]     HPC62_09740    03400 DNA repair and recombination proteins [BR:theu03400]     HPC62_09740 DNA replication proteins [BR:theu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HPC62_09740 Chromosome and associated proteins [BR:theu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HPC62_09740 DNA repair and recombination proteins [BR:theu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HPC62_09740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2267 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QKD82424 UniProt:  A0A6M8B627 LinkDB All DBs Position 2312801..2313076 Genome browser AA seq 91 aa AA seqDB search MNKGELVDAVAEKANVTKKQADAVLSAAIDSIMEAVSKGEKVTLVGFGSFEPRERKEREG RNPKTGEAMKIPATKVPAFSAGKLFKDLVAK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaataaaggtgaattggttgatgccgtagccgaaaaggcaaacgtgacgaagaaacag gccgacgcagtgctgtctgccgcgattgattcgatcatggaagcggtgtcgaagggtgag aaggtgacgctggtggggtttgggtcttttgaaccccgtgagcgcaaggagcgggaaggc cgcaaccccaaaacgggagaggcgatgaaaattcctgcgaccaaagtgcctgccttttcg gcgggcaaactgttcaaagacctggtggcaaaatag

DBGET integrated database retrieval system