Thermoleptolyngbya sichuanensis: HPC62_14190 Help Entry HPC62_14190       CDS       T06607                                  Symbol psbE Name (GenBank) cytochrome b559 subunit alpha   KO K02707   photosystem II cytochrome b559 subunit alpha Organism theu  Thermoleptolyngbya sichuanensis Pathway theu00195   Photosynthesis theu01100   Metabolic pathways Module theu_M00161   Photosystem II theu_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:theu00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     HPC62_14190 (psbE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:theu00194]     HPC62_14190 (psbE) Photosynthesis proteins [BR:theu00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     HPC62_14190 (psbE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  QKD83193 UniProt:  A0A6M8BJD7 LinkDB All DBs Position 3399697..3399942 Genome browser AA seq 81 aa AA seqDB search MAGSTGERPFSDIVTSIRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPNEYFTQER QEVPIVQDRFTAKEQIQEFLK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctggcagcactggagaacgtccattctcagacattgttacaagcatccggtattgg gtaattcacagcattaccattccggctttgtttattgctggatggctgtttgtcagcacg ggtttggcctacgacgtgttcggcacaccgcgtccgaacgaatacttcacgcaagagcgt caagaagtgcccattgtgcaagatcggttcacggcaaaagagcaaatccaggaatttttg aagtag

DBGET integrated database retrieval system