Thermomonas sp. XSG: ICG51_001835 Help Entry ICG51_001835      CDS       T10183                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism thex  Thermomonas sp. XSG Pathway thex00290   Valine, leucine and isoleucine biosynthesis thex00650   Butanoate metabolism thex00660   C5-Branched dibasic acid metabolism thex00770   Pantothenate and CoA biosynthesis thex01100   Metabolic pathways thex01110   Biosynthesis of secondary metabolites thex01210   2-Oxocarboxylic acid metabolism thex01230   Biosynthesis of amino acids Module thex_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine thex_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:thex00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     ICG51_001835    00660 C5-Branched dibasic acid metabolism     ICG51_001835   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     ICG51_001835   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     ICG51_001835 Enzymes [BR:thex01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      ICG51_001835 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  QNU15466 LinkDB All DBs Position complement(1946598..1946831) Genome browser AA seq 77 aa AA seqDB search MRYQLDLTLRRAEGALARVLGTTERRGFQPVSVDGETQDDGDRWHLRMTVEGSREPESLR HQLAGLYDCLAVDVREA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcgctaccagcttgatctcaccctgcgccgcgccgagggcgcgctggcgcgcgtgctg ggcaccaccgagcgacgaggcttccagcccgtcagcgtcgatggcgaaacccaggacgac ggcgaccgctggcacctgcgcatgaccgtggaaggcagccgcgaaccggaaagcctgcgg caccagctggccgggctgtacgactgcctggcggtggacgtacgcgaagcatga

DBGET integrated database retrieval system