Thermomonas sp. XSG: ICG51_001968 Help Entry ICG51_001968      CDS       T10183                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism thex  Thermomonas sp. XSG Pathway thex00190   Oxidative phosphorylation thex01100   Metabolic pathways Module thex_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:thex00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ICG51_001968 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:thex00194]     ICG51_001968 (atpE) Photosynthesis proteins [BR:thex00194]  Photosystem and electron transport system   F-type ATPase [OT]    ICG51_001968 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QNU15590 UniProt:  A0A7H1RMV1 LinkDB All DBs Position 2086281..2086559 Genome browser AA seq 92 aa AA seqDB search MEFIAQVQAYTAIAIGIIVGLGALAAALGIGIMGSKFLESAARQPELVPMLQGRMFLLAG LIDAAFLIGVGVAMMFAFANPLLAAVQAAAGA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggaattcatcgcccaagtccaggcctacaccgccatcgccatcggcatcatcgtcggc ctgggtgccctcgccgccgccctcggcatcggcatcatgggcagcaagttcctcgagtcc gccgcccgccagccggagctggtgccgatgctgcagggccgcatgttcctgctggccggc ctgatcgacgcggcgttcctgatcggcgtcggcgtcgcgatgatgttcgcgttcgccaac ccgctgctggccgccgtccaggctgctgccggcgcctga

DBGET integrated database retrieval system