Thermoanaerobacter sp. RKWS2: OEI98_001345 Help Entry OEI98_001345      CDS       T10300                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism thez  Thermoanaerobacter sp. RKWS2 Pathway thez00020   Citrate cycle (TCA cycle) thez00720   Other carbon fixation pathways thez01100   Metabolic pathways thez01110   Biosynthesis of secondary metabolites thez01120   Microbial metabolism in diverse environments thez01200   Carbon metabolism thez01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:thez00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     OEI98_001345   09102 Energy metabolism    00720 Other carbon fixation pathways     OEI98_001345 Enzymes [BR:thez01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      OEI98_001345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_21 Fer4_7 Fer4_10 Fer4_6 Fer4_9 Fer4_16 Fer4_4 Fer4_8 Fer4_3 LdpA_Fe-S-bd Fer4_17 Fer4_13 Fer4_22 Fer4_15 Fer4_ETF_QO Motif Other DBs NCBI-ProteinID:  UZQ84152 LinkDB All DBs Position 1301413..1301610 Genome browser AA seq 65 aa AA seqDB search MVKNKELVIIEEWCKGCGICVEFCPVKVLELKNGKVRLIDADKCTKCGLCELRCPDFAIY LEVKE NT seq 198 nt NT seq  +upstreamnt  +downstreamnt ttggtaaaaaataaagagctcgtaataatagaagaatggtgcaaaggctgcggcatttgt gtagaattttgtcctgttaaagtattggaactaaaaaatggtaaagttagactaatagat gcggataaatgcactaaatgcggcctttgcgagctccggtgtcctgattttgccatatat ttagaggtgaaagaatga

DBGET integrated database retrieval system