Infirmifilum uzonense: MA03_07045 Help Entry MA03_07045        CDS       T03924                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism thf  Infirmifilum uzonense Pathway thf03010   Ribosome Brite KEGG Orthology (KO) [BR:thf00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MA03_07045   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MA03_07045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:thf03011]     MA03_07045    04121 Ubiquitin system [BR:thf04121]     MA03_07045   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:thf04147]     MA03_07045 Ribosome [BR:thf03011]  Ribosomal proteins   Eukaryotes    Small subunit     MA03_07045   Archaea     MA03_07045 Ubiquitin system [BR:thf04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MA03_07045 Exosome [BR:thf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MA03_07045   Exosomal proteins of colorectal cancer cells    MA03_07045 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_RPB9 DUF7479 Zn_ribbon_SprT TackOD1 Zn_ribbon_PriA Lar_restr_allev DUF1451 YhfH EDR4-like_1st Med16_C Ribosomal_L34e Zn_ribbon_Nudix Ribosomal_L37e Ribosomal_L37ae Phage_zn_bind_2 Zn_ribbon_3 Baculo_ME53 NRDD zf_UBZ zf-tcix Zn_ribbon_ACC DUF6758 Motif Other DBs NCBI-ProteinID:  AKG39045 UniProt:  A0A0F7FI42 LinkDB All DBs Position 1354644..1354802 Genome browser AA seq 52 aa AA seqDB search MAEINKLYEYDYKTGTIKLKNKKCPRCGSIMAHHKKPVERWACGKCGYTEFV NT seq 159 nt NT seq  +upstreamnt  +downstreamnt gtggccgagataaacaagctatacgagtacgactacaagactggcacaatcaagctaaaa aacaagaagtgtcccagatgcggctccataatggcccaccataagaagcccgtagagcgc tgggcctgcggcaagtgcggctacaccgagtttgtataa

DBGET integrated database retrieval system