Thermogladius calderae: TCELL_0248 Help Entry TCELL_0248        CDS       T02127                                  Name (GenBank) Alba, DNA/RNA-binding protein   KO K03622   DNA/RNA-binding protein Alba Organism thg  Thermogladius calderae Brite KEGG Orthology (KO) [BR:thg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:thg03036]     TCELL_0248 Chromosome and associated proteins [BR:thg03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     TCELL_0248 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Alba Motif Other DBs NCBI-ProteinID:  AFK50673 UniProt:  I3TD35 LinkDB All DBs Position 242260..242499 Genome browser AA seq 79 aa AA seqDB search MRRGSIDDYVIEAIVGFQEGPGLVLLKGRGPYISKAVDVYNELVHRLGDGLELVKVEIGS ERVKGRVFSYITISLKKKF NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gtgaggaggggtagtatagacgactacgttatagaggctatagtaggcttccaggaaggg cctggcctcgttttactgaaaggtaggggcccatacatctcgaaagccgtggacgtgtac aacgagctggttcacaggcttggagacgggctcgagctggtgaaggtggagatagggagc gagagggttaaggggagggtgttctcctacataaccatatccttaaagaagaagttctag

DBGET integrated database retrieval system