Thermogladius calderae: TCELL_0552 Help Entry TCELL_0552        CDS       T02127                                  Name (GenBank) 30S ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism thg  Thermogladius calderae Pathway thg03010   Ribosome Brite KEGG Orthology (KO) [BR:thg00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TCELL_0552   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TCELL_0552  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:thg03011]     TCELL_0552    04121 Ubiquitin system [BR:thg04121]     TCELL_0552   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:thg04147]     TCELL_0552 Ribosome [BR:thg03011]  Ribosomal proteins   Eukaryotes    Small subunit     TCELL_0552   Archaea     TCELL_0552 Ubiquitin system [BR:thg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TCELL_0552 Exosome [BR:thg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TCELL_0552   Exosomal proteins of colorectal cancer cells    TCELL_0552 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_PriA Zn_ribbon_RPB9 Zn_ribbon_Nudix IBR_1 Zn_ribbon_3 Baculo_ME53 Ribosomal_L37ae TackOD1 Lar_restr_allev DUF8260 Zn_Ribbon_YjdM DUF1451 EDR4-like_1st Zn_ribbon_TOP3B Zn_ribbon_TFIIB Zn_ribbon_8 DUF2387 Zn_Ribbon_1 Zn_ribbon_ISL3 DZR Zn_ribbon_ACC Motif Other DBs NCBI-ProteinID:  AFK50977 UniProt:  I3TDY9 LinkDB All DBs Position 500431..500604 Genome browser AA seq 57 aa AA seqDB search MARDMAHVHKLYEFDLEKGFIKPKNKKCPKCGSFMAYHKQPVPRWHCGKCGYTEYVR NT seq 174 nt NT seq  +upstreamnt  +downstreamnt gtggctagggacatggcgcacgtccacaaactctacgagtttgacctagagaagggcttc ataaagccgaaaaacaagaagtgcccgaagtgcggcagctttatggcttaccacaaacaa cctgtcccgagatggcactgtgggaagtgcggttacacagagtatgtccggtaa

DBGET integrated database retrieval system