KEGG   Thermogladius calderae: TCELL_0626
Entry
TCELL_0626        CDS       T02127                                 
Name
(GenBank) 30S ribosomal protein S25e
  KO
K02975  small subunit ribosomal protein S25e
Organism
thg  Thermogladius calderae
Pathway
thg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:thg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TCELL_0626
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:thg03011]
    TCELL_0626
Ribosome [BR:thg03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    TCELL_0626
  Archaea
    TCELL_0626
SSDB
Motif
Pfam: Ribosomal_S25 MarR_2 HTH_36 TrmB Fe_dep_repress HTH_24 HTH_11 EAP30 HTH_23 HTH_29 MarR Rrf2 DUF7342 HTH_IclR GntR Dimerisation HTH_20 DnaD_N Penicillinase_R LexA_DNA_bind HTH_28 HTH_Crp_2 MerR
Other DBs
NCBI-ProteinID: AFK51050
UniProt: I3TE62
LinkDB
Position
564705..564971
AA seq 88 aa
MSKKREKAEKPLPPELALTSPDLTGELLAKVEKEIARAEEPYVTPSTIAQKYGVKVSTAK
KILRLLEEKGLVKPVSHTRRTRVYVVVK
NT seq 267 nt   +upstreamnt  +downstreamnt
atgtcgaagaagagggagaaagccgagaagcctctaccacccgagctcgccttaacgtcg
ccggacttgaccggggagttgctggccaaggtcgagaaggagatcgcgagagccgaggaa
ccgtacgtaaccccaagtactatagcgcagaagtacggggtcaaagtgagcactgccaag
aagatcctgaggctactcgaggagaaggggctcgtgaagccggtctctcacacgaggagg
acccgggtctacgtcgtcgtgaagtaa

DBGET integrated database retrieval system