Thermogladius calderae: TCELL_0788 Help Entry TCELL_0788        CDS       T02127                                  Name (GenBank) cobalamin biosynthesis protein   KO K02009   cobalt/nickel transport protein Organism thg  Thermogladius calderae Pathway thg02010   ABC transporters Brite KEGG Orthology (KO) [BR:thg00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     TCELL_0788  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:thg02000]     TCELL_0788 Transporters [BR:thg02000]  ABC transporters, prokaryotic type   Metallic cation, iron-siderophore and vitamin B12 transporters    Cobalt transporter     TCELL_0788    Nickel transporter     TCELL_0788 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PDGLE DUF3679 Motif Other DBs NCBI-ProteinID:  AFK51212 UniProt:  I3TEM4 LinkDB All DBs Position 716706..716987 Genome browser AA seq 93 aa AA seqDB search MKKSVVLLVVLLLLSPVFGVYLANMVGYHEPLDIAGEKLNLTDISDEINWTFLKDYTVPG LPEWLGYVVSGVLGVALIYSIGLLLRKVAERKK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt gtgaagaaatcggtagtactactggtagtgctactgctgttatcgccggtattcggtgtt tacctggctaacatggtggggtaccatgaacccctggacatcgcgggcgaaaaactgaac ttgacagacatctctgacgagatcaactggaccttcctaaaggactacacagtaccaggc ctgcccgaatggcttggttacgtagtctccggagtgctcggagtcgccttgatctactct atagggctgctgctacgtaaagtagcagagaggaagaagtag

DBGET integrated database retrieval system