KEGG   Thalassospira sp. GO-4: M9H61_08790
Entry
M9H61_08790       CDS       T10246                                 
Name
(GenBank) entericidin A/B family lipoprotein
  KO
K16347  entericidin A
Organism
thgo  Thalassospira sp. GO-4
Brite
KEGG Orthology (KO) [BR:thgo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thgo02000]
    M9H61_08790
Transporters [BR:thgo02000]
 Other transporters
  Others
   M9H61_08790
SSDB
Motif
Pfam: Entericidin
Other DBs
NCBI-ProteinID: URK19585
LinkDB
Position
complement(1872669..1872812)
AA seq 47 aa
MVTITKRLLAVAMVLGFGMALSACETAEGFGRDMEKLGQQIQESVNE
NT seq 144 nt   +upstreamnt  +downstreamnt
atggtaacgatcacaaaacgtctgttggcagttgcgatggttcttggctttggcatggcg
ttgtcggcctgcgaaaccgccgaaggatttggccgcgatatggaaaagctgggccagcag
atccaggaaagcgtgaatgagtaa

DBGET integrated database retrieval system