Thermococcus sp. 5-4: CDI07_00255 Help Entry CDI07_00255       CDS       T05088                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism thh  Thermococcus sp. 5-4 Pathway thh03010   Ribosome Brite KEGG Orthology (KO) [BR:thh00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     CDI07_00255   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CDI07_00255  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:thh03011]     CDI07_00255    04121 Ubiquitin system [BR:thh04121]     CDI07_00255   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:thh04147]     CDI07_00255 Ribosome [BR:thh03011]  Ribosomal proteins   Eukaryotes    Small subunit     CDI07_00255   Archaea     CDI07_00255 Ubiquitin system [BR:thh04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    CDI07_00255 Exosome [BR:thh04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CDI07_00255   Exosomal proteins of colorectal cancer cells    CDI07_00255 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Cas12f1-like_TNB Zn_ribbon_IS1595 Lar_restr_allev Zn_ribbon_RPB9 Zn_ribbon_NUD MqsA_antitoxin GFA Zn_ribbon_Nudix Zn_Ribbon_1 Zn_ribbon_3 Motif Other DBs NCBI-ProteinID:  ASA76793 LinkDB All DBs Position complement(52907..53062) Genome browser AA seq 51 aa AA seqDB search MGQKWKLYEVQGGKVKRKNKFCPRCGPGVFMAEHKDRWSCGRCGYTEWKRK NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggggcagaagtggaagctctacgaggttcagggcggtaaggtcaagaggaagaacaag ttctgcccgcgctgcggtccaggcgtcttcatggccgagcacaaggaccgctggagctgc ggccgctgcggctacaccgagtggaagaggaagtga

DBGET integrated database retrieval system