Thermococcus sp. 5-4: CDI07_01815 Help Entry CDI07_01815       CDS       T05088                                  Name (GenBank) cobalt transporter   KO K02009   cobalt/nickel transport protein Organism thh  Thermococcus sp. 5-4 Pathway thh02010   ABC transporters Brite KEGG Orthology (KO) [BR:thh00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     CDI07_01815  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:thh02000]     CDI07_01815 Transporters [BR:thh02000]  ABC transporters, prokaryotic type   Metallic cation, iron-siderophore and vitamin B12 transporters    Cobalt transporter     CDI07_01815    Nickel transporter     CDI07_01815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PDGLE Motif Other DBs NCBI-ProteinID:  ASA77085 UniProt:  A0A1Z2TKV0 LinkDB All DBs Position complement(317409..317657) Genome browser AA seq 82 aa AA seqDB search MRTVFKGLIVIAVVLALVLPLASSNPDGLEATMEKVGLEENPVYHAPLDYGETWGQSVVM GLLGIALAFGVGYGLAKLAKGA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaggacggttttcaagggtctgatcgttatagccgtcgtactggctcttgtgctgccg ctggcctcaagcaacccagatggacttgaggcaacgatggagaaggtcggcctcgaggag aaccccgtctaccacgctccccttgactacggagagacctggggccagagcgtggtgatg ggtctgctcggcatagcactggcgtttggagtcggctacggtttagcaaagctcgcaaag ggtgcctga

DBGET integrated database retrieval system