Thermococcus sp. 5-4: CDI07_02205 Help Entry CDI07_02205       CDS       T05088                                  Name (GenBank) ferredoxin Organism thh  Thermococcus sp. 5-4 Pathway thh00270   Cysteine and methionine metabolism thh01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:thh00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     CDI07_02205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_10 Fer4_21 Fer4_2 Fer4_16 Fer4_9 Fer4_8 Fer4_4 Fer4_18 Fer4_3 Fer4_17 Fer4_13 Fer4_15 Motif Other DBs NCBI-ProteinID:  ASA77151 UniProt:  A0A1Z2TL19 LinkDB All DBs Position complement(387113..387316) Genome browser AA seq 67 aa AA seqDB search MPEKIRVVVNEDKCYLCGGCAGVCPTLAINVSPSRWEFFQDKCIYCRICITACPVGALSA EPLEVGE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgccggagaaaataagggtcgtggttaacgaggacaagtgctatctctgcggtggctgt gctggagtctgcccgacgcttgcaataaacgtaagcccctcgagatgggagttcttccag gacaagtgcatctactgcaggatatgcattaccgcctgcccagtgggcgcactgagcgcc gaacccctggaggtgggagagtga

DBGET integrated database retrieval system