Thermococcus sp. 5-4: CDI07_07075 Help Entry CDI07_07075       CDS       T05088                                  Name (GenBank) hypothetical protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism thh  Thermococcus sp. 5-4 Pathway thh00290   Valine, leucine and isoleucine biosynthesis thh00650   Butanoate metabolism thh00770   Pantothenate and CoA biosynthesis thh01100   Metabolic pathways thh01110   Biosynthesis of secondary metabolites thh01210   2-Oxocarboxylic acid metabolism thh01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:thh00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     CDI07_07075    00660 C5-Branched dibasic acid metabolism     CDI07_07075   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     CDI07_07075   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     CDI07_07075 Enzymes [BR:thh01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      CDI07_07075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT ACT_AHAS_ss ACT_4 ACT_6 Motif Other DBs NCBI-ProteinID:  ASA78071 UniProt:  A0A1Z2TNP2 LinkDB All DBs Position complement(1273669..1274076) Genome browser AA seq 135 aa AA seqDB search MRHYEIVRIRENGKVELPKDYAYELGMVEGAYFLLEIDTDLNEVHMERIALPGKRLVEVE LVVEDRPGVLAKISGLFGRHGANILFSEAEELEGIELAGIVAVIDVSGMSGTLEELKGEL ESLDVVREVTLRPLE NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgaggcactacgagatagttcgtatacgggagaacggcaaggttgagcttcccaaggat tacgcctacgagctcggcatggtggagggcgcgtattttctcctcgagatagacaccgac ctgaacgaggtccacatggagcggatagcgctccctggaaagaggctcgtggaggttgag ctcgtcgtcgaggacagaccgggggttctcgcgaagataagcggactcttcgggaggcac ggggccaacatactcttcagcgaggccgaggagcttgagggcatagagctggcgggaata gttgcggtcatagacgtgagcggaatgagcggcacgctggaggaactcaagggggagctt gaatcgctggacgtcgtgagggaggtcaccctaagaccactggagtag

DBGET integrated database retrieval system