Thiomonas arsenitoxydans: THI_3267
Help
Entry
THI_3267 CDS
T02347
Symbol
accA1
Name
(GenBank) Acetyl-/propionyl-coenzyme A carboxylase alpha chain [Includes: Biotin carboxylase; Biotin carboxyl carrier protein (BCCP)]
KO
K01968
3-methylcrotonyl-CoA carboxylase alpha subunit [EC:
6.4.1.4
]
Organism
thi
Thiomonas arsenitoxydans
Pathway
thi00280
Valine, leucine and isoleucine degradation
thi01100
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:
thi00001
]
09100 Metabolism
09105 Amino acid metabolism
00280 Valine, leucine and isoleucine degradation
THI_3267 (accA1)
Enzymes [BR:
thi01000
]
6. Ligases
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.4 methylcrotonoyl-CoA carboxylase
THI_3267 (accA1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
Biotin_lipoyl
Biotin_lipoyl_2
ATP-grasp
Dala_Dala_lig_C
HlyD_3
BT_MCC_alpha
LAL_C2
ATP-grasp_4
NQRA_N
ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID:
CAZ89863
UniProt:
D6CMT5
LinkDB
All DBs
Position
complement(3181701..3183782)
Genome browser
AA seq
693 aa
AA seq
DB search
MFSKILIANRGEIACRVAATCRRLGIRTVAVYSDADAQAAHVAACDEAVCIGPAEAAQSY
LRGERILQAARDTGAQAIHPGYGFLSENAGFARQCAEAGVVFIGPPPEAMQAMGLKAESK
RLMQTASVPLVPGYHGAEQDAALLKAEAVRIGFPVLIKASAGGGGKGMREVQRVEDFDAA
LASCRREAQSSFGNDAVLIERLVRNPRHIEIQIFADQHDHVLWLFERDCSMQRRHQKVIE
EAPAPGLPDALRREMGEAAVAAARAVGYVGAGTVEFIVECSEAGAPQRFYFMEMNTRLQV
EHPVTELITGLDLVEWQLRVAAGEPLPITQAEVRCSGHAIEARLCAEHPEAGFLPSTGQL
RRLALPPHVAFGAVGAEGIRVDSGVFEGDTITPFYDPMIAKLIAWGETREQARRRLRQAL
AATRIAGLQTNAQFLHRLLGVAAFAGGVLDTGLIAREQEALLAPPSIPQPLACAAAIGAM
LEDERAQQSADPWSAWSPWSICDGFTNGVLPPRVFRFDSPWGVLACTLLTATGQPLRIHT
PGSPQPQPFACSAQSTRVNDVTTEFALVLTLGDERAQMSVVRLGETSFQVFSGGEQVTLQ
ALGADLGSSDGGSAGGRLTAPMPGRIIALHVQAGDTVQTGAPLLVLEAMKMEHTLSAPSA
GQVSEVLYAVGDQVSEGVELLRIEALKTEDLQA
NT seq
2082 nt
NT seq
+upstream
nt +downstream
nt
atgttctcgaaaatcctgatcgccaatcgcggcgagatcgcctgccgggtggccgctacc
tgccgtcggctgggcatccgtaccgtggcggtgtattccgacgccgatgcgcaggcggcg
catgtggcggcgtgcgacgaggcggtgtgcatcggcccggccgaggcggcgcagagctat
ctgcggggtgagcgcatcctgcaggcggcgcgcgacaccggcgcgcaagctatccatccc
ggctatggttttctcagcgagaacgcaggcttcgcgcggcagtgcgccgaggccggggtg
gtgttcatcggcccgccgcccgaggccatgcaggcgatggggctcaaggctgagtccaaa
cggctgatgcaaacggcgtccgtgccgctggtgcccggttatcacggtgcggagcaggac
gcggcgctgctcaaggccgaagccgtgcgcatcggttttccggtgttgatcaaggcgagt
gcgggcggtggcggcaagggcatgcgcgaggtgcagcgcgtcgaagacttcgacgccgcg
ctggcctcgtgccgccgtgaagcgcagagcagtttcggcaacgacgcggtgctcatcgag
cgattggtgcgcaacccgcgccacatcgaaatccagatcttcgcggaccagcacgaccat
gtgttgtggctgttcgagcgcgactgctcgatgcagcgccgtcatcagaaagtcatcgaa
gaagccccggcccccggcctgcctgatgccctgcggcgcgagatgggcgaggccgccgtg
gccgccgcccgagccgtgggttatgtgggcgcgggcacggtggagttcatcgtcgaatgc
agcgaggccggggcgccgcagcgcttctacttcatggagatgaacacgcggctgcaggtc
gagcatcccgtcaccgagttgatcaccggcctcgatctggtcgagtggcaattgcgtgtg
gccgcaggcgaaccgctgcccatcacgcaggccgaggtgcgctgctccgggcatgccatc
gaggcgcggctttgcgcggaacatcccgaggcgggttttctgccttccaccggccagttg
cggcggctggcgttgccgccgcatgtcgctttcggtgcggtgggggcagagggcattcgg
gtcgatagcggggtgttcgagggcgacaccatcaccccgttctacgaccccatgatcgcc
aagctgatcgcctggggcgagacccgcgagcaggcgcgcagacggctgcgccaagcgctg
gccgcgacccgcatcgcgggtttgcagaccaatgcgcagtttctccaccgactgctgggt
gttgcggcgtttgccgggggcgtactcgataccggactgatcgcccgcgagcaagaggcg
ctgctcgcgccgccgtccattccgcagcctttggcctgtgccgctgcgatcggcgccatg
ctcgaagacgagcgcgcgcaacagagcgccgatccgtggtcggcctggtcgccatggtca
atttgcgacgggtttaccaacggcgtgctgccgccgcgcgtgtttcgcttcgacagcccg
tggggtgttttggcgtgcacactgcttacggcgacaggccagcctttgcgcatccatacg
ccgggttcgcctcagccgcagcccttcgcctgctccgcgcaaagcacgcgggtgaacgat
gtcacgacggaattcgccttggttctcacgctgggtgatgagcgtgcgcagatgagcgtg
gttcggctgggcgagacgtcttttcaggtgttttcaggcggcgagcaggttacgctgcaa
gcgctgggcgccgatctgggcagctccgacgggggctcggccggcggccggctgaccgcg
cccatgcccggcagaatcatcgccctgcatgtgcaagcgggcgacacggtgcagaccggc
gccccgctgctggtgctcgaagcgatgaaaatggagcacacgctcagcgccccgtcggcc
gggcaggtgagcgaggtgctttacgcggtgggcgatcaggtcagcgaaggcgtggaactg
ctgcgcatcgaggctttgaaaaccgaggacttgcaggcatga
DBGET
integrated database retrieval system