Thiohalobacter sp. COW1: TspCOW1_20890 Help Entry TspCOW1_20890     CDS       T08363                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism thic  Thiohalobacter sp. COW1 Brite KEGG Orthology (KO) [BR:thic00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:thic03110]     TspCOW1_20890 (groS)    03029 Mitochondrial biogenesis [BR:thic03029]     TspCOW1_20890 (groS) Chaperones and folding catalysts [BR:thic03110]  Heat shock proteins   HSP10    TspCOW1_20890 (groS) Mitochondrial biogenesis [BR:thic03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     TspCOW1_20890 (groS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  BCO31986 UniProt:  A0A7R7JE24 LinkDB All DBs Position complement(2255264..2255554) Genome browser AA seq 96 aa AA seqDB search MNIRPLHDRVIIKRMEEERTTAGGIVIPDSATEKPIRGEVVAVGNGKILENGELRPLDIK VGDKVLFGKYSGTEVKVEDQDLLVMREEDVMAVIEG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaatattcgtccgttgcatgatcgcgtgatcatcaagcgtatggaagaagaacgcacc acggccggtgggatcgtgatcccggactcggcaaccgaaaagcccatccgcggtgaggtg gttgccgtcggtaacggcaagatcctggagaacggcgaactgcgtccgctggacatcaag gtcggcgacaaggtcctgttcggcaagtactccggcaccgaggtcaaggttgaggaccag gatctgctggtcatgcgtgaagaagacgtgatggccgtcatcgagggctga

DBGET integrated database retrieval system