Thiohalobacter sp. COW1: TspCOW1_28770 Help Entry TspCOW1_28770     CDS       T08363                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism thic  Thiohalobacter sp. COW1 Brite KEGG Orthology (KO) [BR:thic00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:thic03036]     TspCOW1_28770 Chromosome and associated proteins [BR:thic03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     TspCOW1_28770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB DUF7491 bZIP_1 GAS TLE_N TSC22 NRBF2 HALZ Herpes_UL6 DivIC Sas-6_C_CC APG6_N SKA2 YabA JIP_LZII DUF6841 DUF4407 SWIRM-assoc_1 DUF2203 CATRA-C Uso1_p115_C HAUS-augmin3 Macoilin DUF16 DUF1664 DUF724 Motif Other DBs NCBI-ProteinID:  BCO32774 UniProt:  A0A7R7GPQ7 LinkDB All DBs Position complement(3053699..3053932) Genome browser AA seq 77 aa AA seqDB search MEKDSVQQMAEQELKRLEFRIDELIRTVERLKEENRSLRAQQHSLTSERSQLVERNEMAR SRVEAMISRLKAMEQST NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggaaaaggacagcgtacaacaaatggcggaacaggaacttaagcgcctggaattccgc attgacgaactgatccgcacggtcgagcggctcaaggaggagaaccgttccctgcgcgcc cagcagcacagcctgacctcggaacggtcccagctggtcgagcgcaacgaaatggcccgc agccgggtcgaggccatgatcagccgcctcaaggccatggagcagagcacgtga

DBGET integrated database retrieval system