Thiohalobacter sp. COW1: TspCOW1_31410 Help Entry TspCOW1_31410     CDS       T08363                                  Name (GenBank) hypothetical protein   KO K03586   cell division protein FtsL Organism thic  Thiohalobacter sp. COW1 Brite KEGG Orthology (KO) [BR:thic00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:thic03036]     TspCOW1_31410 Chromosome and associated proteins [BR:thic03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     TspCOW1_31410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL Motif Other DBs NCBI-ProteinID:  BCO33038 UniProt:  A0A7R7JF28 LinkDB All DBs Position 3336225..3336485 Genome browser AA seq 86 aa AA seqDB search MKLLLALLLAGVIASGIGVVYARHQSRALFVQLQSLLSERDALNIEWGQLQLEQSTLATH GRIERLATERLEMHVPAHDEIILVKP NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgaagctgctgctcgcattgctgctggctggcgtgatcgcttccggtatcggcgtggtc tatgcgcgccaccagagccgggccctgttcgtgcagctgcagtcactgctgagcgaacgg gatgcgttgaacatcgaatgggggcagctgcagctcgagcagagcaccctggccacccat ggccggatcgagcgactggcaaccgagcggctggagatgcatgtgccggcccacgacgaa atcatcctggtgaagccatga

DBGET integrated database retrieval system