Thiohalobacter sp. COW1: TspCOW1_32750
Help
Entry
TspCOW1_32750 CDS
T08363
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
thic
Thiohalobacter sp. COW1
Pathway
thic00190
Oxidative phosphorylation
thic01100
Metabolic pathways
thic02020
Two-component system
Module
thic_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
thic00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
TspCOW1_32750 (petA)
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
TspCOW1_32750 (petA)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
TspCOW1_32750 (petA)
Enzymes [BR:
thic01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
TspCOW1_32750 (petA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UCR_Fe-S_N
Rieske
HSBP1
TAT_signal
Motif
Other DBs
NCBI-ProteinID:
BCO33172
LinkDB
All DBs
Position
3483384..3483974
Genome browser
AA seq
196 aa
AA seq
DB search
MSDGVDTSRRRFLTAATSVVGAVGAVYVAVPFVKSMWPSARAQAAGAPVEVDISKIEPGQ
MLNVEWRGKPVWIVNRTDEMLQSLDELTDRVSDPDSQASEQPEYAQNQARSIKENVLVMV
AICTHLGCSPKYRPDVAPADLGNDWLGGFFCPCHGSKYDLAGRVYKGMPAPLNMPVPPHR
YIGDTVVLVGEDQGAA
NT seq
591 nt
NT seq
+upstream
nt +downstream
nt
atgagtgatggcgtagataccagccggcgccgcttcctcaccgccgccacgagcgtggtc
ggtgccgtgggtgccgtgtatgtggccgttcccttcgtcaagtccatgtggccgagcgcg
cgggcgcaggcggccggggcgccggtggaggtggacatcagcaagatcgagcccggccag
atgctcaacgtggaatggcgcggcaagccggtgtggatcgtcaaccgcaccgacgagatg
ctgcagagcctggatgaactgaccgaccgggtcagcgatcccgactcccaggcctccgag
cagcccgaatacgcccagaaccaggcccgctccatcaaggagaacgtcctggtcatggtc
gccatctgcacccatctgggctgttcgcccaaataccgccccgatgtggccccggccgac
ctgggcaacgactggctgggcggtttcttctgcccctgtcacggctccaagtacgacctg
gccgggcgtgtctacaagggcatgccggcaccgctgaatatgccggtgccgccgcatcgc
tacatcggcgataccgttgtcctcgttggcgaagatcaaggagctgcatga
DBGET
integrated database retrieval system