Thiocapsa sp. M50B4: KFB96_18470 Help Entry KFB96_18470       CDS       T07253                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism thim  Thiocapsa sp. M50B4 Brite KEGG Orthology (KO) [BR:thim00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:thim03110]     KFB96_18470 (groES)    03029 Mitochondrial biogenesis [BR:thim03029]     KFB96_18470 (groES) Chaperones and folding catalysts [BR:thim03110]  Heat shock proteins   HSP10    KFB96_18470 (groES) Mitochondrial biogenesis [BR:thim03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     KFB96_18470 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Beta-barrel_SelB Motif Other DBs NCBI-ProteinID:  QVL47657 LinkDB All DBs Position 4043563..4043853 Genome browser AA seq 96 aa AA seqDB search MKIRPLHDRVVVRRMEEERTTAGGIVIPDSATEKPIQGEIIAVGKGKILDNGESRPLDVK VGDRVLFGKYSGTEVKLDGNDFLVMREEDIMGVVEG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaagattcgtcccctgcacgaccgcgtcgttgtccgtcgcatggaagaagagcgcacg accgccggcggcatcgtaatcccggactccgccaccgagaagccgatccagggcgagatc atcgccgtgggcaagggcaagatcctcgacaacggcgagagccgtccgctggatgtcaag gtcggcgaccgcgtcctgttcggcaagtattccggcaccgaggtcaagctcgacggcaac gatttcctggtgatgcgcgaagaagacatcatgggtgtcgtcgagggctga

DBGET integrated database retrieval system