Thiocapsa sp. M50B4: KFB96_18710 Help Entry KFB96_18710       CDS       T07253                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism thim  Thiocapsa sp. M50B4 Brite KEGG Orthology (KO) [BR:thim00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:thim03036]     KFB96_18710    03400 DNA repair and recombination proteins [BR:thim03400]     KFB96_18710 Chromosome and associated proteins [BR:thim03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     KFB96_18710 DNA repair and recombination proteins [BR:thim03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       KFB96_18710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CcdA Histone_HNS_N HHH_3 Ribosomal_L29 DUF1192 Motif Other DBs NCBI-ProteinID:  QVL47699 LinkDB All DBs Position complement(4097999..4098205) Genome browser AA seq 68 aa AA seqDB search MNDAGSATDSKQGGIDLSTLSDKALEALVPKIQQELAQRRVRQTKEALEKMQEIAKSVGI TPEELLGS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt gtgaacgatgccggtagtgctacagattccaagcagggcgggatcgacctctccacgctc tccgacaaggcactcgaagcactggtgcccaagatccagcaggagctcgcgcaacggcgg gtgcggcagacgaaggaggccctggagaagatgcaagagattgctaagtcggtcggcatt acgccggaggaacttctgggatcctga

DBGET integrated database retrieval system