Candidatus Thioglobus sp. NP1: CRN91_04405 Help Entry CRN91_04405       CDS       T05818                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism thin  Candidatus Thioglobus sp. NP1 Brite KEGG Orthology (KO) [BR:thin00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:thin03032]     CRN91_04405    03036 Chromosome and associated proteins [BR:thin03036]     CRN91_04405    03400 DNA repair and recombination proteins [BR:thin03400]     CRN91_04405 DNA replication proteins [BR:thin03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CRN91_04405 Chromosome and associated proteins [BR:thin03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CRN91_04405 DNA repair and recombination proteins [BR:thin03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CRN91_04405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Nup214_FG HU-CCDC81_euk_2 FlgK_2nd HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AXE61911 UniProt:  A0A344W926 LinkDB All DBs Position 856476..856748 Genome browser AA seq 90 aa AA seqDB search MNKSDLVSAIADSSGLSKADAARALDAATGAISGELAKGGSVAITGFGSFLVRARAARSG RNPQTGATIQIKASNAPAFKAGKLLKESVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatcagatttagtttcagcaatagctgatagctcaggtctttcaaaagctgat gctgctcgtgctttagatgctgcaactggtgcaatttcaggagagcttgcaaaagggggg tctgttgccattacaggttttggtagtttcttggttagagctcgtgcagctcgaagtggt cgcaacccacaaactggtgctactattcaaattaaagcttcaaatgcgccagcttttaaa gcaggtaaattattgaaggaatctgtcaactag

DBGET integrated database retrieval system