Thiomicrospira sp. S5: AYJ59_00520 Help Entry AYJ59_00520       CDS       T05796                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thio  Thiomicrospira sp. S5 Pathway thio01100   Metabolic pathways thio01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thio00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AYJ59_00520    00074 Mycolic acid biosynthesis     AYJ59_00520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AYJ59_00520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AZR80904 UniProt:  A0A3Q9I1R0 LinkDB All DBs Position 121003..121263 Genome browser AA seq 86 aa AA seqDB search MTPEQTEIAEMIIEAVNLEDVTVDEIDPNEPIFNDGLGLDSIDALEISLELNKRYGIKIK SGDQNVGDVFASIAALSEFVQANKQA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacacctgagcaaaccgaaattgcagaaatgattattgaggccgtcaacctggaagat gtgactgtcgatgaaatcgatccgaatgaaccgattttcaatgacggtctgggcttagac tccatcgatgcgctggaaatctcgttggaattgaataagcgttacggcattaaaatcaaa tccggtgatcagaatgtcggcgacgtgtttgcttcgattgcggccttatccgaattcgtt caagccaacaaacaggcctga

DBGET integrated database retrieval system