Thiomicrospira sp. S5: AYJ59_00950 Help Entry AYJ59_00950       CDS       T05796                                  Name (GenBank) ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism thio  Thiomicrospira sp. S5 Pathway thio00190   Oxidative phosphorylation thio01100   Metabolic pathways Module thio_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:thio00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AYJ59_00950  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:thio00194]     AYJ59_00950 Photosynthesis proteins [BR:thio00194]  Photosystem and electron transport system   F-type ATPase [OT]    AYJ59_00950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AZR80985 UniProt:  A0A3S9TK85 LinkDB All DBs Position 217900..218184 Genome browser AA seq 94 aa AA seqDB search MEAQFIADIYAATAIGVGVILAAAGLGSAIGWGLICSKTLEGIARQPEMRPALMTNMFIF AGLMESFPFIILAFAMWFLFANPFVGAMQAALGA NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggaagctcaatttattgcggacatttatgctgctacagcaattggtgtgggtgtgatc ttggctgcggctggtctaggttcagctatcggttggggtctgatctgttctaagactcta gaaggtatcgcacgtcagccagaaatgcgtcctgcgctaatgacaaacatgttcattttc gccggtttgatggaatctttcccattcattatcttggcatttgcaatgtggttcctattc gctaacccattcgtcggagctatgcaagctgctttgggtgcgtaa

DBGET integrated database retrieval system