Thiomicrospira sp. S5: AYJ59_02375 Help Entry AYJ59_02375       CDS       T05796                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism thio  Thiomicrospira sp. S5 Brite KEGG Orthology (KO) [BR:thio00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:thio03110]     AYJ59_02375 Chaperones and folding catalysts [BR:thio03110]  Protein folding catalysts   Protein disulfide isomerase    AYJ59_02375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 SH3BGR Glrx-like Motif Other DBs NCBI-ProteinID:  AZR83123 UniProt:  A0A3Q9I516 LinkDB All DBs Position 523940..524194 Genome browser AA seq 84 aa AA seqDB search MPEVVVYATQTCPFCTMARNLLEGKGVEYQLIDVGNDRAMWAELQAKTGRNTVPQVFVGE HHVGGFDDLSAADNSGELDKLLAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgccggaagtcgtcgtttacgcaacccaaacctgcccgttctgcaccatggcgagaaat ctcctggaaggtaaaggggtggaatatcaattgatcgatgtcggtaacgaccgtgccatg tgggccgagttgcaagccaagaccggtcgtaacactgtgcctcaggtgtttgttggcgaa catcacgtcggcggctttgacgatttgtcggcggcagacaattccggagagctggataag cttttggccggataa

DBGET integrated database retrieval system