KEGG   Thiomicrospira sp. S5: AYJ59_04525
Entry
AYJ59_04525       CDS       T05796                                 
Name
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
thio  Thiomicrospira sp. S5
Pathway
thio00220  Arginine biosynthesis
thio00250  Alanine, aspartate and glutamate metabolism
thio00270  Cysteine and methionine metabolism
thio00330  Arginine and proline metabolism
thio00350  Tyrosine metabolism
thio00360  Phenylalanine metabolism
thio00400  Phenylalanine, tyrosine and tryptophan biosynthesis
thio00401  Novobiocin biosynthesis
thio01100  Metabolic pathways
thio01110  Biosynthesis of secondary metabolites
thio01210  2-Oxocarboxylic acid metabolism
thio01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thio00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AYJ59_04525
   00270 Cysteine and methionine metabolism
    AYJ59_04525
   00220 Arginine biosynthesis
    AYJ59_04525
   00330 Arginine and proline metabolism
    AYJ59_04525
   00350 Tyrosine metabolism
    AYJ59_04525
   00360 Phenylalanine metabolism
    AYJ59_04525
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AYJ59_04525
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    AYJ59_04525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:thio01007]
    AYJ59_04525
Enzymes [BR:thio01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     AYJ59_04525
Amino acid related enzymes [BR:thio01007]
 Aminotransferase (transaminase)
  Class I
   AYJ59_04525
SSDB
Motif
Pfam: Aminotran_1_2 Asp_aminotransf DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Radical_SAM
Other DBs
NCBI-ProteinID: AZR81610
LinkDB
Position
complement(1006639..1007823)
AA seq 394 aa
MSRLSNRVNRVKPSLTLVITAKAAELKRAGKDIISLGAGEPDFDTPDHIKAAGIHAIENG
QTRYTAVDGTPELKDAIIAKFKRDNHLNFAADQILVSSGGKQSFYNLCQGILDDGDEVII
PAPYWVSYPDMALLAGGEPIIIEAGIEQGFKITASQLEAAVTPKTKLVVINSPSNPTGAV
YTPEELKALGEVLTKHPDILIASDDMYEHILLTDTPFTNILEVCPELTDRTVVMNGVSKA
YSMTGWRIGYAGGPKDIIAAMRKVQSQSTSNPCSISQAASVEALNGDQGCIQTMLVEFKK
RHDFVVERINQIPGFKCIPAAGAFYAFMDVRDAMKQKGFETDADFATAILEEVDVAAVPG
SGFGAEGYLRISFATSMDNLVNALDRIDGFMQKA
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgtcccgactgtccaatcgtgttaatcgagtcaaaccctccctgaccttggtcattacc
gccaaagccgccgagctgaaacgcgccgggaaggacatcatcagcttgggcgccggcgaa
ccggatttcgacacccccgaccacatcaaagcggccggcattcacgccattgaaaacggc
caaacccgttacactgccgtggacggcacaccggaactgaaagacgccatcatcgccaaa
ttcaagcgtgacaatcatcttaactttgcggccgaccagattctggtatcgtctggcggg
aaacagagtttttacaatctgtgccaaggcattttggacgacggcgacgaagtgatcatt
cctgcgccttactgggtgtcttacccggacatggctttgctggccggtggcgaaccgatc
attattgaagccggcatcgagcaaggcttcaaaatcaccgcatcacaattggaagcggcg
gttaccccgaaaaccaaactggtggtcatcaacagcccgtccaacccgaccggagccgtc
tacacgccggaagaactgaaagccctcggcgaagtgctcaccaagcacccggacattctg
attgcgtcggacgacatgtatgaacacattttactcaccgacacgccgttcaccaacatc
ctggaagtttgcccggaactgaccgaccgcaccgtggtcatgaacggcgtctccaaagcc
tattcgatgaccggctggcgcatcggttacgccggcggcccgaaagacatcatcgcagcc
atgcgaaaagtgcaatcccaaagcacgtccaacccgtgctcgatttcccaggccgcatcg
gtggaagccctgaacggcgaccaaggttgcattcaaaccatgttggtggaattcaaaaaa
cgccacgatttcgtggtggaacgtatcaatcaaattcccggtttcaagtgcattccggcc
gccggcgctttctatgcctttatggacgtccgcgatgccatgaaacagaaagggtttgag
acggatgccgatttcgccacggcgattctggaagaggtcgacgtcgccgccgtgccggga
tccggctttggtgccgaaggctacttgcgtatctccttcgccaccagcatggacaacttg
gtgaatgctctggatcgcatcgacggcttcatgcaaaaggcttaa

DBGET integrated database retrieval system