Thiomicrospira sp. S5: AYJ59_07400 Help Entry AYJ59_07400       CDS       T05796                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism thio  Thiomicrospira sp. S5 Brite KEGG Orthology (KO) [BR:thio00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:thio03032]     AYJ59_07400    03036 Chromosome and associated proteins [BR:thio03036]     AYJ59_07400    03400 DNA repair and recombination proteins [BR:thio03400]     AYJ59_07400 DNA replication proteins [BR:thio03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AYJ59_07400 Chromosome and associated proteins [BR:thio03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AYJ59_07400 DNA repair and recombination proteins [BR:thio03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AYJ59_07400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 HU-CCDC81_euk_1 HTH_31 Xre-like-HTH HTH_24 HTH_23 Motif Other DBs NCBI-ProteinID:  AZR82123 UniProt:  A0A3S9TNM3 LinkDB All DBs Position complement(1614111..1614383) Genome browser AA seq 90 aa AA seqDB search MNKTELVSAIAEEAGLTKADAAKALEATVSTVTKALSSGDSVAIIGFGTFKVGERSARTG RNPQTGAEMQIPAAKVPKFSAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataagaccgaattagttagtgcgatcgctgaagaagcaggtttaacgaaagcagat gccgctaaagcgctagaagcaactgtgtccactgttacaaaagccttgagctcaggtgat tcagtcgccatcattggatttggtacttttaaagttggtgagcgttcagcacgtactggt cgtaaccctcaaacaggtgcagaaatgcaaatccctgcggcaaaagttcctaagttctca gctggtaaagcacttaaggacgctgttaactaa

DBGET integrated database retrieval system