Thiohalocapsa sp. PB-PSB1: N838_19120 Help Entry N838_19120        CDS       T07019                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thip  Thiohalocapsa sp. PB-PSB1 Pathway thip01100   Metabolic pathways thip01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thip00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N838_19120    00074 Mycolic acid biosynthesis     N838_19120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N838_19120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF2025 Motif Other DBs NCBI-ProteinID:  QQO55143 LinkDB All DBs Position 4508526..4508765 Genome browser AA seq 79 aa AA seqDB search MTTFEQLRSVIADTLGVPEQSIFETSDSNSISVWDSIGHVNLMMALEQTFDVQLDVEIFP QLTSVESILTYLREQGVAG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgacgactttcgagcagctacgctcggtcatcgccgacactctcggcgtacccgagcag tccatcttcgagaccagcgacagcaacagcatatcggtttgggactcgatcggccatgtc aacctgatgatggcgttggaacagaccttcgatgtgcaactggacgtggagattttcccg cagttgacatcggtcgaatccatattgacctatctgcgcgagcagggagtcgccgggtga

DBGET integrated database retrieval system